PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000777060
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family LBD
Protein Properties Length: 264aa    MW: 28569 Da    PI: 6.4999
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000777060genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.32.3e-428106199
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk++Gasnv k+l++l+  +reda++sl+yeAear+rdPvyG+vg+i+ lq++l+q++++l  
  MDP0000777060   8 PCAACKFLRRKCTQECVFAPYFPPDQPQKFANVHKVYGASNVAKILNELNVAHREDAVTSLAYEAEARLRDPVYGCVGFISILQNRLKQVQTDLYN 103
                    7********************************************************************************************988 PP

         DUF260  97 lke 99 
                    +k+
  MDP0000777060 104 AKK 106
                    876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.7097108IPR004883Lateral organ boundaries, LOB
PfamPF031953.9E-428105IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MSSNTHSPCA ACKFLRRKCT QECVFAPYFP PDQPQKFANV HKVYGASNVA KILNELNVAH  60
REDAVTSLAY EAEARLRDPV YGCVGFISIL QNRLKQVQTD LYNAKKDLSA YIGPQAMMIP  120
VFPPPQQTDM NGSVPMLGVS TGPPPQQGCG GGQLVIRDQH QQQLFEAHQQ DLVRFNINGM  180
DTAASSVTGN GFNQIPAAAA SNGVVSGSLG LGGAFDNNHY NQVQQQATAH HQNSLEYQLQ  240
AQLMLQPQPA AEQSQQKSEG EES*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008371805.10.0PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ34e-70LBD36_ARATH; LOB domain-containing protein 36
TrEMBLM5WIQ11e-130M5WIQ1_PRUPE; Uncharacterized protein
STRINGVIT_07s0197g00020.t016e-78(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.15e-65ASYMMETRIC LEAVES 2-like 1